PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g069890.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 581aa    MW: 64479.5 Da    PI: 7.2741
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g069890.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093834152254
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         ++yp+ +++  LA+++gLt +qV++WF N R +
  Sopim11g069890.0.1 383 HPYPTDSDKHMLASQTGLTRNQVSNWFINARVR 415
                         89*****************************87 PP

2BELL101.94.8e-33236301772
                BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +kkakL+ ++ee++krYkqy++q+q+v+ssFe+vagl +a+pY+slAlk++ +hF++L++ai++++
  Sopim11g069890.0.1 236 QKKAKLIFMQEEICKRYKQYHQQMQMVVSSFETVAGLSAATPYISLALKTVVQHFKSLRNAITDHL 301
                         79************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-39154299IPR006563POX domain
PfamPF075261.3E-37161298IPR006563POX domain
PROSITE profilePS5007111.904356419IPR001356Homeobox domain
SMARTSM003892.9E-9359423IPR001356Homeobox domain
CDDcd000862.39E-11359420No hitNo description
SuperFamilySSF466895.56E-17361425IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-28362423IPR009057Homeodomain-like
PfamPF059205.2E-18376415IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MKFIYILYIH IYIFAGKLIG IFTGLEMSDQ VSEFHVAQHS RRERLRITSS EELDIIHQYG  60
NISYDPSVVL SSSEMINFAT TTTGTTDVAQ NCSNWRSLQH SSCGWNNVTN FNSSGSVIET  120
NNYLSPMFVG GERGVLSGSL NLNSSSIDEK PNFYGGFNEL SKFLRPAQQL LDELCDLAAG  180
SSNVIKCSNF SKKVRDGFRV SCDVNAAAES SSGGGGGGVG DSSGLNESNV CPEYLQKKAK  240
LIFMQEEICK RYKQYHQQMQ MVVSSFETVA GLSAATPYIS LALKTVVQHF KSLRNAITDH  300
LKNIRQALGE DLPSPASGMS NKGDGNSSRL KFVDQTSLHK QKSGSTAGVA FLESQQHVWR  360
PQRGLPERAV AILRAWLFDH FLHPYPTDSD KHMLASQTGL TRNQVSNWFI NARVRVWKPM  420
VEEIHMLETK GGDPTRKSDV NKLVTERTNH VNCGQHLSYV LLNMSGVVMP EKQEICHGGI  480
GPSERLDESS SDHHMWRNQE KRSRIECHNI SDGSSMDGSL MGFVPHQRNG VEIGGNIGDV  540
SLTLGLRQNA EAAQQQQQLQ LHEHRLRQQF GGHIIHDFVD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-17365422158Homeobox protein Meis1
4xrs_A4e-17365422158Homeobox protein Meis1
5bng_A5e-17365423159Homeobox protein Meis2
5bng_B5e-17365423159Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251168.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010313437.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLK4DAE50.0K4DAE5_SOLLC; Uncharacterized protein
STRINGSolyc11g069890.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.11e-74BEL1-like homeodomain 8